- Research article
- Open access
- Published:
Swine acute diarrhea syndrome coronavirus nucleocapsid protein antagonizes the IFN response through inhibiting TRIM25 oligomerization and functional activation of RIG-I/TRIM25
Veterinary Research volume 55, Article number: 44 (2024)
Abstract
Swine acute diarrhea syndrome coronavirus (SADS-CoV), an emerging Alpha-coronavirus, brings huge economic loss in swine industry. Interferons (IFNs) participate in a frontline antiviral defense mechanism triggering the activation of numerous downstream antiviral genes. Here, we demonstrated that TRIM25 overexpression significantly inhibited SADS-CoV replication, whereas TRIM25 deficiency markedly increased viral yield. We found that SADS-CoV N protein suppressed interferon-beta (IFN-β) production induced by Sendai virus (SeV) or poly(I:C). Moreover, we determined that SADS-CoV N protein interacted with RIG-I N-terminal two caspase activation and recruitment domains (2CARDs) and TRIM25 coiled-coil dimerization (CCD) domain. The interaction of SADS-CoV N protein with RIG-I and TRIM25 caused TRIM25 multimerization inhibition, the RIG-I-TRIM25 interaction disruption, and consequent the IRF3 and TBK1 phosphorylation impediment. Overexpression of SADS-CoV N protein facilitated the replication of VSV-GFP by suppressing IFN-β production. Our results demonstrate that SADS-CoV N suppresses the host IFN response, thus highlighting the significant involvement of TRIM25 in regulating antiviral immune defenses.
Introduction
Coronaviruses (CoVs) infect various animal species and pose a significant threat to both public health and economies [1]. Over the last two decades, severe acute respiratory syndrome coronavirus-1 (SARS-CoV-1), Middle East respiratory syndrome coronavirus (MERS-CoV) and SARS-CoV-2, have caused severe respiratory disease in humans [2]. As an important livestock species, pigs have been particularly susceptible to severe CoV diseases, thus resulting in substantial economic effects [3]. Porcine epidemic diarrhea virus (PEDV), porcine hemagglutinating encephalomyelitis virus (PHEV), porcine deltacoronavirus (PDCoV), transmissible gastroenteritis virus (TGEV), and porcine respiratory coronavirus (PRCV) are five distinct swine CoVs.
The sixth identified porcine coronavirus, swine acute diarrhea syndrome coronavirus (SADS-CoV), was responsible for two significant outbreaks in China [4]. SADS-CoV, classified as a swine enteric alpha-CoV, induces swine acute diarrhea syndrome in piglets and leads to vomiting, severe diarrhea and weight loss. The mortality rates of 5-day-old piglets affected by SADS-CoV can reach 90% [5]. SADS-CoV (family Coronaviridae, genus alphacoronavirus) is an enveloped, single-stranded positive-sense RNA virus. The genome of SADS-CoV has a typical CoV structure, seven open reading frames encoding four structural proteins, 16 non-structural proteins and an accessory protein [6]. Nucleocapsid (N) proteins have important functions in the transcription, replication, and assembly phases of viruses [7]. N proteins can also act as IFN antagonists. For example, the N protein of PDCoV, PEDV, SARS-CoV-1, SARS-CoV-2 and Mouse hepatitis virus (MHV) suppress IFN production through different mechanisms [8,9,10,11].
The innate immune response, as the initial barrier against pathogens, encompasses the type I interferon (IFN-I) signaling pathway, which plays an essential role in defending against viral infections [12]. After the identification of viral RNA within the cytoplasm, retinoic acid-inducible gene I (RIG-I)-like receptors (RLR) initiate the antiviral response through the activation of signaling cascades [13, 14]. To date, three members of the RLR family have been described: RIG-I, melanoma differentiation-associated gene 5 (MDA5), and laboratory of genetics and physiology 2 (LGP2) [15]. RIG-I is critical for the recognition of most single-stranded RNA (ssRNA) viruses, including all negative-strand RNA viruses and some positive-strand RNA viruses, such as coronavirus [16, 17]. RIG-I comprises N-terminal two caspase activation and recruitment domains (2CARDs), a central DECH box ATPase domain, and a C-terminal regulatory/repressor domain (RD). The ATPase and RD domains of RIG-I recognize viral RNAs, exposing the 2CARDs, which interact with tripartite motif-containing protein 25 (TRIM25). TRIM25, a 71-kDa E3 ubiquitin ligase, has four domains: an N-terminal Really Interesting New Gene (RING) domain, two B-boxes, a coiled-coil dimerization domain (CCD), and a C-terminal SPRY domain. TRIM25 is involved in various cellular processes, such as cell proliferation, differentiation and death, and implicated in innate immune signaling pathways [18]. In the absence of an RNA ligand, RIG-I is held in a closed conformation where the 2CARDs are in association with the RD [19]. However, upon recognition of viral RNA, RIG-I exposes its N-terminal 2CARDs, and TRIM25 triggers the synthesis of lysine 63 (K63)-linked polyubiquitin which binds to the 2CARDs. Subsequently, the oligomerization RIG-I binds with MAVS via CARD-CARD interaction to facilitate IFN-I production [20].
Viruses evade host immune attack by antagonizing antiviral defenses. Specifically, virus-encoded protein impede the innate antiviral responses of the host by selectively targeting the expression of IFN genes or the effector molecules induced by IFN [21]. The N protein, which is encoded by CoVs, is the main IFN antagonist. For example, MERS-CoV N interacts with TRIM25 to suppress both IFN-I and IFN-III production [22]. Similarly, SARS-CoV-1 N protein binds to protein activator of protein kinase R (PACT) and TRIM25 to restrain RIG-I activation [8]. SARS-CoV-2 N protein plays a role in TRIM25 and RIG-I complex by suppressing TRIM25 E3 ligase activity toward RIG-I [9]. PRRSV N protein competitively interferes with TRIM25-RIG-I interaction to inhibit RIG-I ubiquitination. However, the detailed roles of SADS-CoV N protein in suppressing IFN-β production and antiviral gene expression have not been directly investigated.
Here, our findings suggested that TRIM25 is upregulated after SADS-CoV infection and significantly inhibits SADS-CoV infection. We identified that SADS-CoV N protein interacts with TRIM25 CCD domain and RIG-I 2CARDs, which inhibits TRIM25 multimerization and TRIM25-RIG-I interaction, thereby suppresses RIG-I signaling and IFN-β production. The study offered valuable mechanism that may facilitate therapeutic drugs development against Coronaviridae family members infection.
Materials and methods
Cell culture and virus
Porcine intestinal epithelial cells (IPI-2I) and human embryonic kidney cells (HEK293T) were cultured in Dulbecco’s modified Eagle’s medium (DMEM; Sigma-Aldrich, St Louis, USA) containing 10% fetal bovine serum (Invitrogen, USA) and 1% antibiotic–antimycotic (Invitrogen, USA). The SADS-CoV (GenBank accession No. MF094681) was described previously [23]. Sendai virus (SeV) was purchased from the China Center for Type Culture Collection (Wuhan University, China). The recombinant GFP tagged Vesicular Stomatitis Virus (VSV-GFP) was kindly provided by Prof. Zhigao Bu (Harbin Veterinary Research Institute, China).
Plasmids and antibodies
Pig full-length TRIM25 (GenBank accession number XM_005656971.3) was cloned from IPI-2I cells cDNA and reconstructed with pCMV-Flag (635,688, Clontech) and pCAGGS-HA (P0166, Miaoling Biology) vectors. The deletion mutants of TRIM25 (RING_1–90 aa, B-boxes_91–200 aa, CCD_180–450 aa, and SPRY_451–630 aa) were constructed on the basis of the full-length TRIM25 plasmid and inserted into the pAcGFP-C1 (632,470, Clontech) vector to generate green fluorescent protein (GFP) fusion proteins. TRIM25 DelCCD (lacking the CCD domain) was cloned into the pCAGGS-HA vector, and we named the recombinant plasmid pHA-TRIM25 DelCCD. GFP-SADS-CoV N and N truncated plasmids were stored in our laboratory as previously described [24]. The plasmids of RIG-I and IFN-β-Luc were stored in our laboratory as previously described [25]. The RIG-I truncated mutants (RIG-IN, RIG-IC and RIG-I 2CARDs) were amplified from the full-length RIG-I and inserted into the pCMV-Flag and pCAGGS-GST vectors to generate the recombinant plasmids Flag-RIG-IN, Flag-RIG-IC and GST-2CARDs, respectively. The sequences of the PCR primers used in this study are listed in Additional file 2. Monoclonal antibodies specific for SADS-CoV N protein were stocked in our laboratory [24]. We purchased antibody against DDDDK (ab205606), HA (ab9110), TBK1 (ab40676), p-TBK1 (ab109272), IRF3 (ab68481), p-IRF3 (ab76493), GFP (ab290), GST (ab138491) or TRIM25 (ab167154) from Abcam (Cambridge, MA, USA). We purchased antibody against Flag (F3165), Myc (M4439) or GAPDH (G9545) from Sigma-Aldrich (St. Louis, MO, USA). RNase A, Alexa Fluor™ 488 or 647 goat anti-mouse IgG (H + L) and Alexa Fluor™ 594 goat anti-rabbit IgG (H + L) secondary antibodies were purchased from Thermo Fisher Scientific (Carlsbad, CA, USA). Poly(I:C) was purchased from InvivoGen (Hong Kong, China).
RNA interference
Three siRNAs targeting TRIM25 were designed by Shanghai Gene Pharma (Shanghai, China); the target sequences were as follows: siTRIM25-1 (sense, 5'-GGCTCACATTGATGCTTAT-3'), siTRIM25-2 (sense, 5'-GCTGAGGCATAAACTGACT-3'), and siTRIM25-3 (sense,5'-GCGATCACGGCTTTGTCAT-3'). SiTRIM25 and siNC negative control were transfected into IPI-2I cells with Lipofectamine RNAiMAX reagent (13778150, Thermo Fisher Scientific, USA). After 36 h transfection, we infected the cells with SADS-CoV at a multiplicity of infection (MOI) of 0.1. The levels of SADS-CoV N mRNA and protein in the infected cells were detected at 24 hours post-infection (hpi).
Dual-luciferase reporter assays
We seeded HEK293T cells in 24-well plates, and transfected with luciferase reporter plasmids (IFN-β-Luc) and the indicated plasmid alone or together with SADS-CoV N plasmid for 24 h (pRL-TK Renilla luciferase reporter plasmid as an internal control). After 24 h transfection, we test the luciferase activity using a dual luciferase reporter assay kit (E1901, Promega, USA).
Confocal fluorescence microscopy
The plasmid-transfected HEK293T cells and SADS-CoV -non-infected or -infected Vero E6 cells were fixed with 4% paraformaldehyde (16005, Sigma-Aldrich, USA) at 4 °C for 30 min, and permeabilized with 1% Triton X-100 (T8787, Sigma-Aldrich) at room temperature for 15 min. After 5% skim milk blocking at 37 °C for 2 h, cells were incubated with different primary antibodies at 4 °C overnight. After PBS-Tween-20 (PBS containing 0.05% Tween-20; P1379, Sigma-Aldrich) washing, cells were incubated with Alexa Fluor™ 594/488 conjugated secondary antibody at room temperature for 1 h. After PBST washing, cells were counterstained with 4',6-diamidino-2-phenylindole (DAPI) for 15 min, fluorescence images were directly captured under a LSM880-ZEISS confocal laser scanning microscope equipped with Fast Airyscan (Carl Zeiss AG, Oberkochen, Germany).
RNA extraction and real-time PCR
Total RNA was extracted with a RNeasy Mini Kit (52906, Qiagen, Germany), and reverse transcription was performed with PrimeScript™ IV 1st strand cDNA Synthesis Mix (6215A, Takara, Japan). Real-time PCR was conducted with TB Green Premix Ex Taq™ II (RR820A, Takara, Japan) on a QuantStudio 5 real-time PCR system (Applied Biosystems, Carlsbad, USA). The fold change in gene expression levels was calculated with the comparative CT (ΔΔCT) method as described previously [26]. All experiments were performed in at least triplicate. The primers used in the qRT-PCR assays are listed in Additional file 3.
Western blotting analysis
Whole cell lysates of IPI-2I cells and HEK293T cells were prepared after SADS-CoV infection or transfection with the indicated plasmids in six-well plates. The contents of each well were lysed with RIPA lysis buffer (R0278, Sigma-Aldrich, USA) with 1 mM PMSF (ST506-2, Beyotime) on ice for 30 min. After centrifuging at 12 000 × g at 4 °C for 20 min, sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) loading buffer was added to the supernatant and boiled for 10 min. Proteins were separated with 12.5% SDS-PAGE, then transferred to nitrocellulose membranes at 300 mA for 120 min. After 5% skim milk blocking for 2 h, the membranes were incubated with different primary antibodies at 4 °C for 6–8 h, and then incubated with IRDye 800CW goat anti-mouse lgG (H + L) (1:10 000) (926-32210, LiCor BioSciences) or IRDye 680RD goat anti-rabbit lgG (H + L) (1:10 000) (926-68071, LiCor BioSciences) for 1 h. The membranes were then visualized with Odyssey infrared imaging system (LiCor BioSciences, USA).
Native PAGE
HEK293T cells were transfected with HA-TRIM25 in the presence or in the absence of Myc-SADS-CoV N. Twenty-four hours after transfection, the cells were lysed with lysis buffer (87788, Thermo Fisher Scientific) on ice for 30 min and then centrifuged at 12 000 × g at 4 °C for 10 min to remove the insoluble fraction. The whole-cell extracts were mixed with native PAGE sample loading buffer (Beyotime) and separated with 8% Native polyacrylamide Gel in running buffer containing 1% sodium deoxycholate at 4 °C, as previously described [27]. After electrophoresis, proteins were transferred to nitrocellulose membranes and analyzed by Western blotting with anti-HA antibody.
Immunoprecipitation
We performed the immunoprecipitation assays as described previously [28]. Plasmid-transfected HEK293T cells were lysed with IP lysis buffer (87788, Thermo Fisher Scientific), which contained 1 mM PMSF and 1 mg/mL protease inhibitor cocktail (04693132001, Roche) on ice for 30 min. Five percent of the cell lysate was collected as input, and the remainder was incubated with the indicated primary antibody at 4 °C overnight, then precipitated with Protein A/G agarose beads (78609, Thermo Fisher Scientific) for 6 h. After five times washing, the beads were collected and analyzed with Western blotting.
Flow cytometry analysis
After 24 h transfection with Myc-SADS-CoV N, HEK293T cells were infected with VSV-GFP for 12 h. Subsequently, we harvested and resuspended the cells in PBS. Basing on the background signal emitted by uninfected cells, cells were subjected to gating for GFP signals. Fluorescence intensity was tested through BD FACSCalibur instrument. The data analysis was performed in FlowJo software.
Viral titration
IPI-2I cells were infected with SADS-CoV after HA-TRIM25 or siTRIM25 transfection. The culture supernatants were collected at 24 hpi. Vero E6 cells were infected with tenfold serial dilutions of each supernatant. At 4–6 days post-infection, cytopathic effects in cells were observed through microscopy. We used the Spearman-Kärber method to calculate the median tissue culture infective dose (TCID50).
Experimental infection of piglets
We performed the piglets infection experiment as described previously [23]. We randomly separated six 3 days old specific pathogen free (SPF) piglets into the challenge and control group. The challenge group was orally infected with 5 × 104 TCID50 of SADS-CoV, whereas the control group was orally infected with the same volume DMEM. We recorded the clinical symptoms (vomiting and diarrhea), and euthanized all piglets at 36 hpi. Intestinal tissues were collected for Western blotting and qRT-PCR analyses.
Statistical analysis
The figures display the mean and standard deviation (SD) of results obtained from three independent experiments. Data were analyzed in Graph Pad Prism 8.0. Error bars represent the mean ± SD. P values were calculated using two-tailed unpaired Student’s t-test.
Results
Upregulation of TRIM25 by SADS-CoV infection in vitro and in vivo
Previous studies have indicated that multiple virus infection affect the expression of TRIM25 [29, 30]. To determine the expression level and potential role of TRIM25 in SADS-CoV infection, we infected IPI-2I cells with 0.1 MOI SADS-CoV. After qRT-PCR and Western blotting analysis, we observed marked upregulation of both TRIM25 mRNA and protein at 8, 24, and 48 hpi (Figures 1A and B). In addition, SADS-CoV significantly upregulated the expression of TRIM25 with increasing SADS-CoV MOI values (Figures 1C and D). To explore whether SADS-CoV infection might upregulate the expression of TRIM25 in vivo, the ileum and jejunum tissue from SADS-CoV-infected piglets at 36 hpi were dissected. SADS-CoV infection was confirmed by immunohistochemistry with a specific mAb (3E9) against the SADS-CoV N protein (Figure 1E). The protein levels of TRIM25 in SADS-CoV-infected ileum and jejunum tissue exhibited a significant increase compared with the control group (Figures 1F and G). Meanwhile, TRIM25 mRNA levels were higher in infected group (Figures 1H and I). Together, these results suggested that TRIM25 was upregulated by SADS-CoV infection in vitro and in vivo.
TRIM25 affects SADS-CoV replication
To determine the role of TRIM25 in SADS-CoV infection, IPI-2I cells were transfected with TRIM25 expression plasmid and infected with SADS-CoV. Western blotting showed that the N protein levels of SADS-CoV significantly decreased in a dose-dependent manner by TRIM25 overexpression (Figure 2A). In agreement with the observed changes in protein levels, increased TRIM25 expression was associated with decreases in mRNA levels of N protein ranging from 34.2% to 76.43% in IPI-2I cells, according to qRT-PCR (Figures 2B and C). Furthermore, TCID50 assays indicated that the titer of released virus decreased after TRIM25 overexpression (Figure 2D). Together, these results indicated that TRIM25 upregulation inhibited SADS-CoV replication.
To further ascertain the effect of TRIM25 on SADS-CoV replication, three siRNAs targeting TRIM25 were synthesized. The qRT-PCR results showed that TRIM25 mRNA levels decreased significantly after transfection of IPI-2I cells with siTRIM25-1 (Figure 2E). In contrast, the mRNA level of the viral N gene exhibited an increase (Figure 2F). IPI-2I cells was transfected with siTRIM25-1 at different concentrations, and subsequently infected with 0.1 MOI SADS-CoV for 24 h. As shown in Figure 2G, siTRIM25-1 promoted SADS-CoV propagation. The qRT-PCR results indicated lower TRIM25 mRNA levels (Figure 2H) and higher SADS-CoV N mRNA levels (Figure 2I) than observed in the siNC group. Furthermore, TCID50 assays indicated that the viral titer was greater after TRIM25 knockdown than control siNC transfection (Figure 2J). These results indicated that TRIM25 silencing promoted SADS-CoV replication. Together, our results suggested that TRIM25 acts as an antiviral factor inhibiting SADS-CoV infection.
TRIM25 interacts with SADS-CoV N
CoVs N protein is highly abundant in infected cells and has a crucial function in viral transcription and assembly [31, 32]. SARS-CoV-1 and PRRSV N protein inhibit IFN-I production by competitively interfering with TRIM25-RIG-I interaction and suppressing RIG-I ubiquitination [33, 34]. SADS-CoV, SARS-CoV-1, and PRRSV belong to the Nidovirales order, and TRIM25 also has important roles in the cellular anti-SADS-CoV response, we next investigated whether SADS-CoV N protein might interact with TRIM25 and antagonize its antiviral effects. To test this possibility, we assessed the interaction between TRIM25 and SADS-CoV N protein. We found that Myc-tagged SADS-CoV N interacted with HA-tagged TRIM25 protein (Figure 3A). In addition, we immunoprecipitated virus-infected IPI-2I cells with anti-SADS-CoV N mAb (3E9), then performed Western blotting. As shown in Figure 3B, endogenous TRIM25 co-immunoprecipitated with SADS-CoV N protein. To eliminate the effects of RNA interference on the interaction between TRIM25 and the N protein of SADS-CoV, we used RNase A to remove any RNA molecules present in the experimental system. The SADS-CoV N-TRIM25 interaction was not impeded in the presence of RNase A, suggesting that the interaction between TRIM25 and SADS-CoV N protein did not rely on RNA (Figure 3C). Additionally, the co-localization of SADS-CoV N and TRIM25 was observed through indirect immunofluorescence (Figures 3D and E). These data indicated that TRIM25 interacted with the SADS-CoV N protein.
Amino acids 215–249 of SADS-CoV N protein interact with TRIM25 CCD domain and inhibit CCD-dependent TRIM25 oligomerization
To clarify the specific region of SADS-CoV N protein required for SADS-CoV N-TRIM25 interaction, we co-transfected HEK293T cells with GFP-tagged truncated fragments of SADS-CoV N protein (aa 1–146, 147–249, and 250–376) with HA-TRIM25. Co-IP assays revealed that the N2 domain of SADS-CoV N (aa 147–249) was the essential region for SADS-CoV N-TRIM25 interaction (Figures 4A and B). In contrast, the other truncated regions of SADS-CoV N protein were not responsible for this association. To further determine the necessary amino acid residues in SADS-CoV N2 domain (aa 147–249) directing the SADS-CoV N-TRIM25 interaction, we constructed a series of overlapping recombinant N2 truncated mutant proteins and determined their interaction with TRIM25 through Co-IP assays (Figure 4C). As shown in Figure 4D, GFP-N2c and GFP-N2b + N2c were responsible for the interaction with TRIM25. These results further suggested that S215PAPAPKPARKQMDKPEWKRVPNSEEDVRKCFGPR249 of N protein is the key region for SADS-CoV N-TRIM25 interaction. To enhance understanding of the SADS-CoV N-TRIM25 interaction, we comprehensively analyzed the structural domains necessary for TRIM25 binding to SADS-CoV N proteins, by using a series of GFP-tagged deletion mutants (Figure 4E). As depicted in Figure 4F, the CCD domain of TRIM25 interacted with SADS-CoV N, whereas the other domains did not show any interaction. Furthermore, the CCD deletion TRIM25 mutant (TRIM25 Del CCD) was unable to bind SADS-CoV N protein (Figure 4G). The coiled coil region of the TRIM family proteins primarily participated in homo-oligomeric interactions, and promoted the formation of a hypersecondary structure with multiple a helices [35]. Mutants lacking the CCD region of TRIM25 cannot multimerize [36]. Given that SADS-CoV N interacted with the CCD domain of TRIM25, we next tested whether SADS-CoV N might interfere with TRIM25 multimerization. Indeed, SADS-CoV N expression effectively inhibited CCD-mediated TRIM25 multimerization (Figures 4H and I).
SADS-CoV N protein interferes with TRIM25-RIG-I interaction
Given that TRIM25 is a RIG-I regulatory partner, our subsequent studies were designed to determine SADS-CoV N-RIG-I interaction. To test this possibility, we investigated the SADS-CoV N-RIG-I interaction through Co-IP. On the basis of precipitation with antibodies against Flag or Myc tag, we determined that RIG-I interacted with SADS-CoV N protein (Figure 5A). Further Co-IP assays indicated that only full-length SARS-CoV N interacted with RIG-I (Figure 5B). We also generated Flag-tagged N-terminal (Flag-RIG-IN) and C-terminal (Flag-RIG-IC) constructs and assessed them in Co-IP experiments (Figure 5C). Co-IP assays revealed that the SADS-CoV N protein interacted with Flag-RIG-I and Flag-RIG-IN, but not Flag-RIG-IC (Figure 5D). To further establish that the RIG-I 2CARDs was sufficient for interaction with SADS-CoV N, GST-RIG-I-2CARDs and Myc-SADS-CoV N were co-transfected in HEK293T cells. The results indicated that the N-terminal 2CARDs of RIG-I was crucial for SADS-CoV N-RIG-I interaction (Figure 5E). To explore the localization of the N/RIG-I, and TRIM25/RIG-I, and N/TIRM25/RIG-I complexes, we performed confocal microscopy. Imaging showed that RIG-I was colocalized with SADS-CoV N and TRIM25 in the cytoplasm (Figure 5F). These results further suggested that SADS-CoV N interacts with the RIG-I.
Study showed that TRIM25 SPRY domain interacted with RIG-I, which induced K63-linked ubiquitination of the RIG-I N-terminal 2CARDs, thereby markedly activating RIG-I downstream signaling [37]. Given the association of the RIG-I N-terminal 2CARDs with SADS-CoV N protein, we speculated that the binding of RIG-I to TRIM25 might be affected by SADS-CoV N protein. To examine this possibility, we co-expressed HA-TRIM25 and Flag-RIG-I in HEK293T cells, both with and without Myc-SADS-CoV N. Co-IP assays revealed that overexpression of SADS-CoV N protein attenuated TRIM25-RIG-I interaction, which was a dose-dependent manner (Figure 5G). Thus, SADS-CoV N protein competitively binds RIG-I N-terminal 2CARDs and interferes with the TRIM25-RIG-I interaction.
SADS-CoV N protein suppresses IFN-β production
To explore whether the presence of SADS-CoV N protein in the RIG-I/TRIM25 complex might inhibit RIG-I downstream signaling and IFN-β production, HEK293T were transfected with Myc-N or Myc expression plasmid for 24 h, and then infected with Sendai virus (SeV) or stimulated with poly(I:C) for another 12 h. SADS-CoV N protein inhibited the IFN-β promoter activity inducing by SeV and poly(I:C) (Figures 6A and B). qRT-PCR analysis indicated that the expression of SADS-CoV N protein decreased the SeV- or poly(I:C)-induced transcription of IFN-β, CXCL10, and ISG56 in HEK293T cells (Figures 6C and D) and IPI-2I cells (Additional files 1A and B). Consistently, ectopic expression of SADS-CoV N inhibited the phosphorylation of IRF3 and TBK1 stimulated by SeV and poly(I:C) in HEK293T cells (Figures 6E and F) and IPI-2I cells (Additional files 1C and D). These data indicated that SADS-CoV N protein suppresses IFN-β production. To examine whether SADS-CoV N protein might regulate RIG-I mediated IFN-β activation, HEK293T cells were transfected with firefly luciferase reporter plasmid, empty vector, or SADS-CoV N and RIG-I expression plasmid. The RIG-I induced IFN-β promoter activation was significantly suppressed in a dose-dependent manner by SARS-CoV N protein (Figure 6G). Similarly, N protein of SADS-CoV inhibited RIG-I mediated IFN-β transcription (Figure 6H). Furthermore, luciferase assays and qRT-PCR indicated that TRIM25 further enhanced IFN-β promoter activity and transcription levels by acting on RIG-I; however, SADS-CoV N decreased the TRIM25-mediated RIG-I signaling enhancement (Figures 6I and J). We next investigated whether SADS-CoV N protein might regulate VSV-GFP infection and proliferation. Fluorescence microscopy, flow cytometry, and Western blotting showed that Myc-N plasmid-transfected HEK293T cells, compared with vector-treated cells, facilitated the replication of VSV-GFP, as measured by GFP signaling (Figures 6K–M), thus suggesting that SADS-CoV N inhibits the secretion of antiviral factors. Collectively, these data indicated that SADS-CoV N inhibits the TRIM25-mediated enhancement of RIG-I signaling.
Discussion
SADS-CoV infection entails a multifaceted interplay between virus and host. Understanding the SADS-CoV and host protein interaction can not only elucidate the mechanism of viral infection but also identify antiviral factors. The E3 ubiquitin ligase tripartite motif-containing protein 25 (TRIM25) plays an important role in antiviral activities. TRIM25 not only directly antagonizes viral replication by degrading viral proteins, but also regulates signal transduction pathways induced by innate immune sensors [29, 38]. During viral infection, TRIM25 mediates lysine 63- linked ubiquitination of the N-terminal 2CARDs of the viral RNA sensor retinoic acid-inducible gene I (RIG-I) to facilitate IFN-I production and antiviral immunity [37]. In the present study, it was determined that the crucial RIG-I activating protein TRIM25 acted as a novel host restriction factor in SADS-CoV infection. Experimental results demonstrated that SADS-CoV N protein interacted with both TRIM25 and RIG-I protein, leading to the inhibition of TRIM25/RIG-I complex formation and the subsequent suppression of IFN-β induction. These findings contribute to a more comprehensive understanding of the intricate regulatory interplay between SADS-CoV and host immune responses.
A multitude of TRIM family proteins have significant functions in the inhibition of viral replication. After viral infection, the mRNA and protein level of several TRIM protein are upregulated; these proteins subsequently act as host factors promoting the production of IFNs and inhibiting viral replication. TRIM14 is upregulated after HSV-1 infection and positively regulates type I IFN signaling [39]. TRIM22, a restriction factor, is upregulated at both the mRNA and protein levels in influenza A virus infected human alveolar epithelial A549 cells [40]. In the current study, SADS-CoV infection upregulated the levels of TRIM25 mRNA and protein in vitro and in vivo (Figure 1). The most prominent role of TRIMs is inhibition of viral replication. TRIM56 impairs hepatitis B virus, PEDV, yellow fever virus, and human coronavirus OC43 infection [41,42,43]. TRIM5α inhibits human immunodeficiency virus type 1 (HIV-1) infection [44]. We found that upregulation of TRIM25 restricts SADS-CoV infection, whereas downregulation of this protein enhances SADS-CoV infection (Figure 2). Therefore, TRIM25 is a novel host factor that exerts inhibitory effects on SADS-CoV replication.
The N proteins of different coronaviruses are highly conservated and perform multiple functions during viral infection [6]. TRIM25 is targeted by MERS-CoV N [22] and SARS-CoV N protein [33] for immune evasion. Similarly, SADS-CoV N protein also interacts with TRIM25 (Figure 3). The NS215-R249 domain of SADS-CoV N was critical for binding TRIM25 in vitro. Despite variations in length and primary sequence among nucleoproteins from different coronaviruses, a conserved three-domain organization has been identified. Notably, domain II of the N protein is highly conserved, as compared with domains I and III [45]. The NS215-R249 domain of SADS-CoV N protein is in domain II. TRIM25 consists of a RING-finger domain, two B-box domains, a central CCD, and a C-terminal SPRY domain [38]. SADS-CoV N protein interacts with TRIM25 and targets the TRIM25 CCD, thereby disrupting TRIM25 multimer formation (Figure 4). The formation of TRIM25 multimers acts a pivotal role in RIG-I 2CARDs ubiquitination—a crucial modification necessary for the optimal IFN production in response to viral infection [37]. SADS-CoV N interacts with TRIM25, and inhibits the signal transduction of RIG-I and IFN-β production. The similarity of the observed mechanism to those used by paramyxovirus V [46] and influenza A virus NS1 [36] demonstrates that TRIM25 may be a common viral target for RIG-I antagonism. Interestingly, despite SADS-CoV N and paramyxovirus V both targeting TRIM25, our data indicated that SADS-CoV N utilized a different mechanism to inhibit TRIM25 and RIG-I compared with paramyxovirus V. Paramyxovirus V targets TRIM25 SPRY domain, whereas SADS-CoV N protein interacts with TRIM25 CCD domain. Despite these differences, SADS-CoV N, paramyxovirus V, and influenza A virus NS1 proteins ultimately similarly suppress RIG-I signaling ubiquitination/activation by precluding TRIM25 binding to RIG-I.
Viruses evolving to inhibit antiviral activity induced by IFN is well-documented. For instance, viral protein specifically impedes RIG-I- mediated the signal transduction. Influenza A virus NS1 inhibits the IFN-I induction via the interaction with RIG-I [47]. We found SADS-CoV N interacts with the N-terminal 2CARDs of RIG-I, thus reducing the TRIM25-RIG-I interaction (Figure 5). However, only full-length SARS-CoV N interacts with RIG-I. The structural integrity of SADS-CoV N is essential for its interaction with RIG-I, and the regulation of SADS-CoV N binding to RIG-I is complex. At this stage, the detailed structural basis of this process is unknown, and the mechanism underlying modulation of the 2CARDs of RIG-I by SADS-CoV N also deserves further research. TRIM25-SADS-CoV N-RIG-I interaction supports the hypothesis that N protein may potentially impede the progression of TRIM25-RIG-I downstream signaling pathway. Different coronavirus N proteins have been indicated to inhibit IFN production. PDCoV N protein suppresses Riplet-induced ubiquitination of RIG-I through interaction with porcine RIG-I and TRAF3 protein [48]. SARS-CoV-1 and MHV N proteins interaction with PACT protein attenuates the activation of RIG-I and MDA5 [8]. PEDV N protein interferes with TBK1-mediated IRF3 phosphorylation and thus inhibits IFN-β expression [11]. Our current results indicated that ectopic expression of SADS-CoV N protein significantly inhibited mRNA expression of IFN-β, CXCL10 and ISG56 induced by SeV or poly I:C, and RIG-I activity. Overexpression of SADS-CoV N protein in HEK293T cells enhanced the replication of VSV-GFP (Figure 6). Thus, the SADS-CoV N protein facilitates viral replication by inhibiting the host interferon response.
In conclusion, our results suggested that TRIM25 impeded SADS-CoV replication. Furthermore, SADS-CoV N protein inhibits TRIM25 multimerization and TRIM25-RIG-I interaction to antagonize antiviral activity. In addition, SADS-CoV N suppressed IFN-β production and facilitated VSV-GFP replication. Our findings elucidate a significant molecular mechanism through which SADS-CoV utilizes its N protein to evade innate immune response mediated by TRIM25, thus providing an explanation of the natural viral defense mechanism and potentially facilitating the development of more effective strategies for controlling SADS-CoV infection.
Availability of data and materials
The data that support the findings of this study are available from the authors on reasonable request.
References
Zhou P, Yang XL, Wang XG, Hu B, Zhang L, Zhang W, Si HR, Zhu Y, Li B, Huang CL, Chen HD, Chen J, Luo Y, Guo H, Jiang RD, Liu MQ, Chen Y, Shen XR, Wang X, Zheng XS, Zhao K, Chen QJ, Deng F, Liu LL, Yan B, Zhan FX, Wang YY, Xiao GF, Shi ZL (2020) A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 579:270–273
Hu B, Guo H, Zhou P, Shi ZL (2021) Characteristics of SARS-CoV-2 and COVID-19. Nat Rev Microbiol 19:141–154
Tizard IR (2020) Vaccination against coronaviruses in domestic animals. Vaccine 38:5123–5130
Zhou P, Fan H, Lan T, Yang XL, Shi WF, Zhang W, Zhu Y, Zhang YW, Xie QM, Mani S, Zheng XS, Li B, Li JM, Guo H, Pei GQ, An XP, Chen JW, Zhou L, Mai KJ, Wu ZX, Li D, Anderson DE, Zhang LB, Li SY, Mi ZQ, He TT, Cong F, Guo PJ, Huang R, Luo Y et al (2018) Fatal swine acute diarrhoea syndrome caused by an HKU2-related coronavirus of bat origin. Nature 556:255–258
Li K, Li H, Bi Z, Gu J, Gong W, Luo S, Zhang F, Song D, Ye Y, Tang Y (2018) Complete genome sequence of a novel swine acute diarrhea syndrome coronavirus, CH/FJWT/2018, isolated in Fujian, China, in 2018. Microbiol Resour Announc 7:e01259-18
Yang YL, Liang QZ, Xu SY, Mazing E, Xu GH, Peng L, Qin P, Wang B, Huang YW (2019) Characterization of a novel bat-HKU2-like swine enteric alphacoronavirus (SeACoV) infection in cultured cells and development of a SeACoV infectious clone. Virology 536:110–118
McBride R, van Zyl M, Fielding BC (2014) The coronavirus nucleocapsid is a multifunctional protein. Viruses 6:2991–3018
Ding Z, Fang L, Yuan S, Zhao L, Wang X, Long S, Wang M, Wang D, Foda MF, Xiao S (2017) The nucleocapsid proteins of mouse hepatitis virus and severe acute respiratory syndrome coronavirus share the same IFN-beta antagonizing mechanism: attenuation of PACT-mediated RIG-I/ MDA5 activation. Oncotarget 8:49655–49670
Gori Savellini G, Anichini G, Gandolfo C, Cusi MG (2021) SARS-CoV-2 N protein targets TRIM25-mediated RIG-I activation to suppress innate immunity. Viruses 13:1439
Likai J, Shasha L, Wenxian Z, Jingjiao M, Jianhe S, Hengan W, Yaxian Y (2019) Porcine deltacoronavirus nucleocapsid protein suppressed IFN-beta production by interfering porcine RIG-I dsRNA-binding and K63-linked polyubiquitination. Front Immunol 10:1024
Ding Z, Fang L, Jing H, Zeng S, Wang D, Liu L, Zhang H, Luo R, Chen H, Xiao S (2014) Porcine epidemic diarrhea virus nucleocapsid protein antagonizes beta interferon production by sequestering the interaction between IRF3 and TBK1. J Virol 88:8936–8945
Takeuchi O, Akira S (2009) Innate immunity to virus infection. Immunol Rev 227:75–86
Weber M, Gawanbacht A, Habjan M, Rang A, Borner C, Schmidt AM, Veitinger S, Jacob R, Devignot S, Kochs G, Garcia-Sastre A, Weber F (2013) Incoming RNA virus nucleocapsids containing a 5’-triphosphorylated genome activate RIG-I and antiviral signaling. Cell Host Microbe 13:336–346
Rehwinkel J, Tan CP, Goubau D, Schulz O, Pichlmair A, Bier K, Robb N, Vreede F, Barclay W, Fodor E, Reis e Sousa C, (2010) RIG-I detects viral genomic RNA during negative-strand RNA virus infection. Cell 140:397–408
Takeuchi O, Akira S (2010) Pattern recognition receptors and inflammation. Cell 140:805–820
Kato H, Takahasi K, Fujita T (2011) RIG-I-like receptors: cytoplasmic sensors for non-self RNA. Immunol Rev 243:91–98
Batool M, Kim MS, Choi S (2022) Structural insights into the distinctive RNA recognition and therapeutic potentials of RIG-I-like receptors. Med Res Rev 42:399–425
Rajsbaum R, Garcia-Sastre A, Versteeg GA (2014) TRIMmunity: the roles of the TRIM E3-ubiquitin ligase family in innate antiviral immunity. J Mol Biol 426:1265–1284
Saito T, Hirai R, Loo YM, Owen D, Johnson CL, Sinha SC, Akira S, Fujita T, Gale M Jr (2007) Regulation of innate antiviral defenses through a shared repressor domain in RIG-I and LGP2. Proc Natl Acad Sci U S A 104:582–587
Chen Y, Xu Q, Li Y, Liu R, Huang Z, Wang B, Chen G (2016) Gene expression profile after activation of RIG-I in 5’ppp-dsRNA challenged DF1. Dev Comp Immunol 65:191–200
Garcia-Sastre A, Biron CA (2006) Type 1 interferons and the virus-host relationship: a lesson in detente. Science 312:879–882
Chang CY, Liu HM, Chang MF, Chang SC (2020) Middle east respiratory syndrome coronavirus nucleocapsid protein suppresses type I and type III interferon induction by targeting RIG-I signaling. J Virol 94:e00099-20
Zhang J, Han Y, Shi H, Chen J, Zhang X, Wang X, Zhou L, Liu J, Ji Z, Jing Z, Ma J, Shi D, Feng L (2020) Swine acute diarrhea syndrome coronavirus-induced apoptosis is caspase- and cyclophilin D-dependent. Emerg Microbes Infect 9:439–456
Han Y, Zhang J, Shi H, Zhou L, Chen J, Zhang X, Liu J, Wang X, Ji Z, Jing Z, Cong G, Ma J, Shi D, Li F (2019) Epitope mapping and cellular localization of swine acute diarrhea syndrome coronavirus nucleocapsid protein using a novel monoclonal antibody. Virus Res 273:197752
Xing Y, Chen J, Tu J, Zhang B, Chen X, Shi H, Baker SC, Feng L, Chen Z (2013) The papain-like protease of porcine epidemic diarrhea virus negatively regulates type I interferon pathway by acting as a viral deubiquitinase. J Gen Virol 94:1554–1567
Zhao L, Li L, Xue M, Liu X, Jiang C, Wang W, Tang L, Feng L, Liu P (2021) Gasdermin D inhibits coronavirus infection by promoting the noncanonical secretion of beta interferon. MBio 13:e0360021
Chen X, Yang X, Zheng Y, Yang Y, Xing Y, Chen Z (2014) SARS coronavirus papain-like protease inhibits the type I interferon signaling pathway through interaction with the STING-TRAF3-TBK1 complex. Protein Cell 5:369–381
Shi D, Shi H, Sun D, Chen J, Zhang X, Wang X, Zhang J, Ji Z, Liu J, Cao L, Zhu X, Yuan J, Dong H, Chang T, Liu Y, Feng L (2017) Nucleocapsid interacts with NPM1 and protects it from proteolytic cleavage, enhancing cell survival, and is involved in PEDV growth. Sci Rep 7:39700
Wang S, Yu M, Liu A, Bao Y, Qi X, Gao L, Chen Y, Liu P, Wang Y, Xing L, Meng L, Zhang Y, Fan L, Li X, Pan Q, Cui H, Li K, Liu C, He X, Gao Y, Wang X (2021) TRIM25 inhibits infectious bursal disease virus replication by targeting VP3 for ubiquitination and degradation. PLoS Pathog 17:e1009900
Tan G, Xiao Q, Song H, Ma F, Xu F, Peng D, Li N, Wang X, Niu J, Gao P, Qin FX, Cheng G (2018) Type I IFN augments IL-27-dependent TRIM25 expression to inhibit HBV replication. Cell Mol Immunol 15:272–281
Chen CJ, Sugiyama K, Kubo H, Huang C, Makino S (2004) Murine coronavirus nonstructural protein p28 arrests cell cycle in G0/G1 phase. J Virol 78:10410–10419
Hurst KR, Ye R, Goebel SJ, Jayaraman P, Masters PS (2010) An interaction between the nucleocapsid protein and a component of the replicase-transcriptase complex is crucial for the infectivity of coronavirus genomic RNA. J Virol 84:10276–10288
Hu Y, Li W, Gao T, Cui Y, Jin YW, Li P, Ma QJ, Liu X, Cao C (2017) The severe acute respiratory syndrome coronavirus nucleocapsid inhibits type I interferon production by interfering with TRIM25-mediated RIG-I ubiquitination. J Virol 91:e02143-16
Zhao K, Li LW, Jiang YF, Gao F, Zhang YJ, Zhao WY, Li GX, Yu LX, Zhou YJ, Tong GZ (2019) Nucleocapsid protein of porcine reproductive and respiratory syndrome virus antagonizes the antiviral activity of TRIM25 by interfering with TRIM25-mediated RIG-I ubiquitination. Vet Microbiol 233:140–146
Meroni G, Diez-Roux G (2005) TRIM/RBCC, a novel class of “single protein RING finger” E3 ubiquitin ligases. BioEssays 27:1147–1157
Gack MU, Albrecht RA, Urano T, Inn KS, Huang IC, Carnero E, Farzan M, Inoue S, Jung JU, García-Sastre A (2009) Influenza A virus NS1 targets the ubiquitin ligase TRIM25 to evade recognition by the host viral RNA sensor RIG-I. Cell Host Microbe 5:439–449
Gack MU, Shin YC, Joo CH, Urano T, Liang C, Sun L, Takeuchi O, Akira S, Chen Z, Inoue S, Jung JU (2007) TRIM25 RING-finger E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity. Nature 446:916–920
van Gent M, Sparrer KMJ, Gack MU (2018) TRIM proteins and their roles in antiviral host defenses. Annu Rev Virol 5:385–405
Chen MX, Meng QC, Qin YF, Liang PP, Tan P, He L, Zhou YB, Chen YJ, Huang JJ, Wang RF, Cui J (2016) TRIM14 inhibits cGAS degradation mediated by selective autophagy receptor p62 to promote innate immune responses. Mol Cell 64:105–119
Di Pietro A, Kajaste-Rudnitski A, Oteiza A, Nicora L, Towers GJ, Mechti N, Vicenzi E (2013) TRIM22 inhibits influenza A virus infection by targeting the viral nucleoprotein for degradation. J Virol 87:4523–4533
Tian X, Dong HJ, Lai XY, Ou GM, Cao JN, Shi JH, Xiang CA, Wang L, Zhang XC, Zhang K, Song J, Deng J, Deng HK, Lu SC, Zhuang H, Li T, Xiang KH (2022) TRIM56 impairs HBV infection and replication by inhibiting HBV core promoter activity. Antiviral Res 207:105406
Liu BM, Li NL, Wang J, Shi PY, Wang TY, Miller MA, Li K (2014) Overlapping and distinct molecular determinants dictating the antiviral activities of TRIM56 against Flaviviruses and Coronavirus. J Virol 88:13821–13835
Xu XG, Wang LX, Liu Y, Shi XJ, Yan YC, Zhang SX, Zhang Q (2022) TRIM56 overexpression restricts porcine epidemic diarrhoea virus replication in Marc-145 cells by enhancing TLR3-TRAF3-mediated IFN-β antiviral response. J Gen Virol 103:001748
Ribeiro CMS, Sarrami-Forooshani R, Setiawan LC, Zijlstra-Willems EM, van Hamme JL, Tigchelaar W, van der Wel NN, Kootstra NA, Gringhuis SI, Geijtenbeek TBH (2016) Receptor usage dictates HIV-1 restriction by human TRIM5α in dendritic cell subsets. Nature 540:448–452
Zúñiga S, Sola I, Moreno JL, Sabella P, Plana-Durán J, Enjuanes L (2007) Coronavirus nucleocapsid protein is an RNA chaperone. Virology 357:215–227
Sánchez-Aparicio MT, Feinman LJ, García-Sastre A, Shaw ML (2018) Paramyxovirus V proteins interact with the RIG-I/TRIM25 regulatory complex and inhibit RIG-I signaling. J Virol 92:e01960-17
Pichlmair A, Schulz O, Tan CP, Naslund TI, Liljestrom P, Weber F, Reis e Sousa C, (2006) RIG-I-mediated antiviral responses to single-stranded RNA bearing 5’-phosphates. Science 314:997–1001
Seth RB, Sun LJ, Ea CK, Chen ZJJ (2005) Identification and characterization of MAVS, a mitochondrial antiviral signaling protein that activates NF-κB and IRF3. Cell 122:669–682
Acknowledgements
We thank Zhigao Bu (Harbin Veterinary Research Institute, China) for providing recombinant GFP tagged Vesicular Stomatitis Virus (VSV-GFP), Jingyun Ma (South China Agricultural University, China) for providing SADS-CoV strain.
Funding
This research was funded by the Regional Innovation and Development Joint Fund of National Natural Science Foundation of China, grant number U23A20236; the National Key R&D Program of China, grant number 2021YFD1801105; and the Central Public-interest Scientific Institution Basal Research Found, grant number 1610302022015.
Author information
Authors and Affiliations
Contributions
Conceptualization: JZ, DS, and LF. Methodology: JZ, ZJ (Zhaoyang Ji), XZ, DL, XY, MZ, DS, and LF. Experiment operation: JZ, LZ, ZJ (Zhaoyang Jing), and TF. Supervision: DS and LF. Data analysis: JZ, HS, JC, XZ, DS, and LF. Writing—original draft: JZ. Writing—review and editing: JZ, DS, and LF. All authors read and approved the final manuscript.
Corresponding authors
Ethics declarations
Ethics approval and consent to participate
The animal experiments were approved by Harbin Veterinary Research Institute. The animal ethics committee approval number was 231108–05-GR.
Competing interests
The authors declare that they have no competing interests.
Additional information
Handling editor: Stéphane Biacchesi
Publisher's Note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Supplementary Information
Additional file 1. SADS-CoV N protein suppresses IFN-β production in IPI-2I cells.
A, B SADS-CoV N inhibits the transcription of IFN-β, CXCL10, and ISG56 after SeV infection and poly(I:C) transfection in IPI-2I cells. IPI-2I cells were transfected with empty vector or Myc-N for 36 h. Cells were stimulated with SeV infection (A) or poly(I:C) transfection (B) for 12 h. The relative mRNA levels of IFN-β, CXCL10, and ISG56 were evaluated by qRT-PCR. C, D SADS-CoV N inhibits phosphorylation of IRF3 and TBK1 stimulated by SeV and poly(I:C) in IPI-2I cells. IPI-2I cells were transfected with empty vector or Myc-N for 36 h. Cells were stimulated with SeV infection (C) or poly(I:C) transfection (D) for 12 h. The cell lysates were subjected to Western blotting analysis.
Additional file 3.
qRT-PCR primer sequences used in this study.
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
About this article
Cite this article
Zhang, J., Shi, H., Zhang, L. et al. Swine acute diarrhea syndrome coronavirus nucleocapsid protein antagonizes the IFN response through inhibiting TRIM25 oligomerization and functional activation of RIG-I/TRIM25. Vet Res 55, 44 (2024). https://0-doi-org.brum.beds.ac.uk/10.1186/s13567-024-01303-z
Received:
Accepted:
Published:
DOI: https://0-doi-org.brum.beds.ac.uk/10.1186/s13567-024-01303-z